PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_16526.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 55aa    MW: 6554.56 Da    PI: 4.2136
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_16526.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.71.7e-17955148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             +ppGfrFhPt+eelv +yL +k+++ k +l +vi e+d+yk+ePwd++
  Rsa1.0_16526.1_g00001.1  9 MPPGFRFHPTEEELVGYYLDRKINSMKSSL-DVIVEIDLYKMEPWDIQ 55
                             79*************************999.99************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-18454IPR003441NAC domain
PROSITE profilePS5100520.101955IPR003441NAC domain
PfamPF023651.2E-81052IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
MDNIMQSCMP PGFRFHPTEE ELVGYYLDRK INSMKSSLDV IVEIDLYKME PWDIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-149541560Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0216659e-64AC021665.7 Arabidopsis thaliana chromosome 1 BAC F17M19 genomic sequence, complete sequence.
GenBankAY0854249e-64AY085424.1 Arabidopsis thaliana clone 151034 mRNA, complete sequence.
GenBankBT0264479e-64BT026447.1 Arabidopsis thaliana At1g71930 mRNA, complete cds.
GenBankCP0026849e-64CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302544.11e-31hypothetical protein CARUB_v10020645mg
RefseqXP_010471212.12e-31PREDICTED: NAC domain-containing protein 7-like
RefseqXP_010471211.12e-31PREDICTED: NAC domain-containing protein 7-like
RefseqXP_010471210.12e-31PREDICTED: NAC domain-containing protein 7-like
RefseqXP_010471209.12e-31PREDICTED: NAC domain-containing protein 7-like
RefseqXP_010415913.12e-31PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9C8W92e-33NAC30_ARATH; NAC domain-containing protein 30
TrEMBLR0GHU91e-31R0GHU9_9BRAS; Uncharacterized protein
STRINGAT1G71930.16e-31(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-34vascular related NAC-domain protein 7